Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Browse files
Browse the repository at this point in the history
Merge branch 'master' of github.com:bioperl/bioperl-live
- Loading branch information
Showing
6 changed files
with
121 additions
and
6 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
|
@@ -2,6 +2,7 @@ | |
.tmp | ||
*# | ||
.#* | ||
.*.swp | ||
*(Autosaved)blib* | ||
Build | ||
Build.bat | ||
|
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
File renamed without changes.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,95 @@ | ||
ID NC_003888; SV 3; linear; unassigned DNA; STD; UNC; 8667507 BP. | ||
XX | ||
AC NC_003888; | ||
XX | ||
DT 03-MAR-2010 | ||
XX | ||
DE Streptomyces coelicolor A3(2), complete genome. | ||
XX | ||
KW complete genome | ||
XX | ||
OS Streptomyces coelicolor A3(2) (2) | ||
OC Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales; | ||
OC Streptomycineae; Streptomycetaceae; Streptomyces. | ||
XX | ||
RN [1] | ||
RP 1-8667507 | ||
RX PUBMED; 12000953. | ||
RA Bentley,S.D., Chater,K.F., Cerdeno-Tarraga,A.M., Challis,G.L., | ||
RA Thomson,N.R., James,K.D., Harris,D.E., Quail,M.A., Kieser,H., Harper,D., | ||
RA Bateman,A., Brown,S., Chandra,G., Chen,C.W., Collins,M., Cronin,A., | ||
RA Fraser,A., Goble,A., Hidalgo,J., Hornsby,T., Howarth,S., Huang,C.H., | ||
RA Kieser,T., Larke,L., Murphy,L., Oliver,K., O'Neil,S., Rabbinowitsch,E., | ||
RA Rajandream,M.A., Rutherford,K., Rutter,S., Seeger,K., Saunders,D., | ||
RA Sharp,S., Squares,R., Squares,S., Taylor,K., Warren,T., Wietzorrek,A., | ||
RA Woodward,J., Barrell,B.G., Parkhill,J. and Hopwood,D.A.; | ||
RT Complete genome sequence of the model actinomycete Streptomyces coelicolor | ||
RT A3(2); | ||
RL Nature 417 (6885), 141-147 (2002) | ||
XX | ||
RN [2] | ||
RP 1-8667507 | ||
RX PUBMED; 8843436. | ||
RA Redenbach,M., Kieser,H.M., Denapaite,D., Eichner,A., Cullum,J., | ||
RA Kinashi,H. and Hopwood,D.A.; | ||
RT A set of ordered cosmids and a detailed genetic and physical map for the 8 | ||
RT Mb Streptomyces coelicolor A3(2) chromosome; | ||
RL Mol. Microbiol. 21 (1), 77-96 (1996) | ||
XX | ||
RN [3] | ||
RP 1-8667507 | ||
RA ; | ||
RT Direct Submission; | ||
RL Submitted (28-MAY-2002) National Center for Biotechnology Information, | ||
RL NIH, Bethesda, MD 20894, USA | ||
XX | ||
RN [4] | ||
RP 1-8667507 | ||
RA Bentley,S.D.; | ||
RT Direct Submission; | ||
RL Submitted (09-MAY-2002) Sanger Institute, Wellcome Trust Genome Campus, | ||
RL Hinxton, Cambridge CB10 1SA, United Kingdom | ||
XX | ||
CC PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI | ||
CC review. The reference sequence was derived from AL645882. On Jun 22, 2003 | ||
CC this sequence version replaced gi:31340543. COMPLETENESS: full length. | ||
XX | ||
FH Key Location/Qualifiers | ||
FH | ||
FT gene 5241975..5243546 | ||
FT /locus_tag="SCO4814" | ||
FT /db_xref="GeneID:1100255" | ||
FT /gene_synonym="SCD63A.25" | ||
FT /gene="purH" | ||
FT CDS 5241975..5243546 | ||
FT /locus_tag="SCO4814" | ||
FT /gene_synonym="SCD63A.25" | ||
FT /protein_id="NP_628971.1" | ||
FT /gene="purH" | ||
FT /transl_table=11 | ||
FT /note="involved in de novo purine biosynthesis" | ||
FT /db_xref="GI:21223192" | ||
FT /db_xref="GeneID:1100255" | ||
FT /codon_start=1 | ||
FT /translation="MTATAGSNKRAIRRALVSVYDKTGLEDLARGLHEAGVELVSTGST | ||
FT AGRIAAAGVPVTKVEELTGFPECLDGRVKTLHPKVHAGILADLRLESHRQQLDELGVAP | ||
FT FDLVVVNLYPFRETVASGATPDECVEQIDIGGPSMVRAAAKNHPSVAVVTSPARYADVL | ||
FT LAVEGGGFDLAARKRLAAEAFQHTAAYDVAVASWFAAEYAPVDESGFPDFLGATYERAN | ||
FT TLRYGENPHQPAALYTSPEGGGLAQAEQLHGKEMSYNNYTDTDAARRAAYDHAEPCVAI | ||
FT IKHANPCGIAIGADVAEAHRKAHDCDPVSAYGGVIAVNRPVSKEMAERVAGIFTEVIVA | ||
FT PDYEDGALEALTKKKNIRVLRAPAAPAAPVEVKPIDGGALLQVTDRLQAEGDDPATWTL | ||
FT ATGEALSEAELAELAFAWRACRAVKSNAILLAKDGASVGVGMGQVNRVDSAKLAVERAG | ||
FT AERAQGAYAASDAFFPFPDGLEILTGAGVKAVVQPGGSVRDELVVEAAKKAGVTMYFTG | ||
FT TRHFFH" | ||
FT /product="bifunctional | ||
FT phosphoribosylaminoimidazolecarboxamide | ||
FT formyltransferase/IMP cyclohydrolase" | ||
FT /EC_number="3.5.4.10" | ||
FT /EC_number="2.1.2.3" | ||
FT misc_feature 5242401..5243345 | ||
FT /locus_tag="SCO4814" | ||
FT /gene_synonym="SCD63A.25" | ||
FT /gene="purH" | ||
FT /note="Pfam match to entry PF01808 AICARFT_IMPCHas, | ||
FT AICARFT/IMPCHase bienzyme, score 508.80, E-value 4.2e-149" | ||
// |